Which of the following terms best describes a vertical line that the graph of a function approaches but never intersects

Answers

Answer 1

Answer: an asymptote is, essentially, a line that a graph approaches , but     does not intersect.      

Step-by-step explanation:

for example , in the following graph of y =1x y=1x the line approaches the x- axis (y=0) but never touches it


Related Questions

The stock of Company A lost 2% today to $73.50. What was the opening price of the stock in the beginning of the day?

Answers

The opening price of the stock in the beginning of the day will be $75.

What is the percentage?

The quantity of anything is stated as though it were a fraction of a hundred.

The stock of Company A lost 2% today to $73.50.

Let x be the opening price of the stock in the beginning of the day.

Then the opening price of the stock in the beginning of the day will be

0.98 · x = 73.5

         x = 73.5 / 0.98

         x = $75

More about the percentage link is given below.

https://brainly.com/question/8011401

#SPJ1

Help me with this question please!! :)

Answers

Answer: 20/63

Step-by-step explanation:

The probability that the first marble is red is 16/28.The probability that the second marble is red is 15/27.

Multiplying these probabilities, we get (16/28)(15/27) = 20/63

What is the value of the expression 24 + 3²? What is the value of the expression 24 + 3² ? ​

Answers

Answer:

33

Step-by-step explanation:

3² = 3.3 = 9 => 24 + 9 = 33

Factor out the GCF from the polynomial.
r(2²-24) + (2²-24)

Answers

Answer: -20

Step-by-step explanation: i hope its right

Which results only in a horizontal compression of Y=1/x
by a factor of 6?

Answers

Step-by-step explanation:

[tex] y = \frac{1}{x} [/tex]

In order to compress by a factor of 6, we multiply the variable x by 6. It would compress the hyperbola

[tex]y = \frac{1}{6x} [/tex]

what is the variable equal to y8=40

Answers

y8=40
You can divide 40 by 8 and you get 5. y=5

Answer:

5

Step-by-step explanation:

We need to isolate the variable, aka make y on one side. So, if we divide 8 on both sides, it will be

y8=40

y8/8=40/8

y=5

6x -8=16 solve equation

Answers

Answer:

x = 4

Step-by-step explanation:

6x - 8 = 16 (add 8 to both sides)

6x = 24 (divide by 6 on both sides)

x = 4

Brainliest, please :)

Step-by-step explanation:

6x=16+8

6x=24

6x/6=24/6

x=4

so the answer is 4

The sequence an = 1(3)n − 1 is graphed below: coordinate plane showing the points 1, 1; 2, 3; and 3, 9 Find the average rate of change between n = 1 and n = 3. (6 points)

Answers

Answer:

4

Step-by-step explanation:

[tex] \frac{9 - 1}{3 - 1} = 4[/tex]

The average rate of change on the interval [3, 9] will be 4.

How to find the average rate of change?

The average rate of change between two points is given by the slope formula:

 m = average rate of change = (y2 -y1)/(x2 -x1)

The sequence an = 1(3)n − 1 is graphed below:

 m = (9 -1)/(3 -1) = 8/2

 m = 4

The average rate of change on the interval [3, 9] will be 4.

Learn more about average rate;

https://brainly.com/question/12395856

#SPJ1

3a =2b + -6 (solve for a)

Answers

Answer:

shown below

Step-by-step explanation:

3a = 2b - 6

a = (2b - 6) / 3 or 2b / 3 - 2

Answer:

a = (2b-6)/3

Step-by-step explanation:

3a = 2b + -6

lets make a the subject of the formula

divide both sides of the equation by 3

3a/3 = a = (2b-6)/3

a = (2b-6)/3

Please help, been stuck on this for ages!

Answers

Answer:

[tex]\boxed {192 cm^{2}}[/tex]

Step-by-step explanation:

Find the volume of separate cuboids :

Volume (top cuboid) :

⇒ V = 2 x 6 x (10 - 2)

⇒ V = 12 x 8

⇒ V = 96 cm²

Volume (lower cuboid) :

⇒ V = 8 x 6 x 2

⇒ V = 48 x 2

⇒ V = 96 cm²

Volume (prism) :

⇒ 96 + 96

192 cm²

What is the surface area of the cylinder below?

Answers

Answer:

Surface Area = 378.25

Step-by-step explanation:

Comment

It's not clear whether the figure has 0 1 or 2 lids. Since it is a cylinder, I will assume 2 lids like a can of soup.

Area lids

diameter = 11.4

radius = d/2

radius = 11.4/2

radius = 5.7

Area = pi * r^2

Area = (3.14 * 5.7^2) * 2 There are 2 lids.

Area =   102.01 yd^2

Area body

This is found by finding the circumference of the lid and multiplying by the height

Circumference

C = 2*pi*r

2*r = the diameter

2*r = 11.4

C = 3.14*11.4

C = 35.80

Area body

Area body = C* h

h = 7.8

Area body = 35.80 * 7.8

Area body = 279.24

Total Area = 102.01 + 279.24 = 378.25

When completing the square on the equation c^2 + 11c = 12, the resulting solution is

Answers

Answer:

Attached file is the solutions

Step-by-step explanation:

list 4 factors of 24. list 4 multiples of 24.​

Answers

Answer:

Factors of 24: 1, 2, 3, 4, 6 etc.

Multiples of 24: 48, 72, 96, 120

Step-by-step explanation:

Answer:

See below

Step-by-step explanation:

Factors of 24:

24 can be written as:

= 1 × 24

= 2 × 12

= 3 × 8

= 4 × 6

So, 1, 2, 3, 4, 6, 8, 12 and 24 are the factors of 24.

Multiples of 24 are:

1 × 24 = 24

2 × 24 = 48

3 × 24 = 72

4 × 24 = 96

and so on...

So, the first 4 multiples of 24 are 24, 48, 72 and 96.

[tex]\rule[225]{225}{2}[/tex]

Find the measure of PR.

Answers

The length of PR = 18 .

What is a Chord ?

A chord is a line segment whose both points lie on the circle.

When a chord is extended it is called secant .

When two chords meet outside the circle , the product of length of the secant and its external segment is equal to the product of length of other secant and its external segment.

According to the given data

FR and FP are the secants of the circle

To determine the measure of PR

From the secant theorem

(7+9) * 9 = (5x+8) * 8

16 * 9 = (5x+8) *8

2 *9 = 5x+8

18 = 5x+8

5x = 10

x = 2

Therefore the length of PR = 5x+8 = 10+8 = 18

To know more about Chord

https://brainly.com/question/8944240

#SPJ1

A company gives each worker a cash bonus every Friday, randomly giving a worker an amount with these probabilities: $10 - 0.75, $50 - 0.25. Over many weeks, what is a worker's expected weekly bonus?

Answers

The worker's expected weekly bonus is $30.0

How to determine the worker's expected weekly bonus?

The amounts and the probabilities are given as:

x    $10       $50

P(x)  0.75    0.25

The worker's expected weekly bonus is calculated as:

[tex]E(x) = \sum x * P(x)[/tex]

So, we have:

E(x) = $10 * 0.75 + $50 * 0.25

Evaluate the product

E(x) = $17.5 + $12.5

Evaluate the sum

E(x) = $30.0

Hence, the worker's expected weekly bonus is $30.0

Read more about expected values at:

https://brainly.com/question/15858152

#SPJ1

An electrician charges a $40 fee to make a house call plus an hourly rate for labor. If the total bill that takes 2 hours comes to $99 what is the electrician hourly labor rate?

Answers

Answer $29.50
Reason
You can use the formula y=mx+b for this
We know y is the total bill of $99
We know b is the $40 fee (y intercept or starting point)
We know x is 2 hours
We are looking for m or rate
Substitute numbers for letters in formula
99= m(2) +40
Subtract 40 from both sides to isolate m
59=2m
Divide both sides by 2 to solve for m
M=$29.50
We can prove our answer by inserting our answer for “m” in the formula
99=29.50x2+40
99=99
Answer is correct

what is the answer to the question?

Answers

Using logic concepts, the correct statement is given by:

[tex](p \vee \neg p) \wedge \neg q[/tex]. FALSE.

What are the events in this problem?

The events are:

Event P: Henry is wearing a red shirt.Event Q: Henry is wearing khaki shirts.

The statement is:

Henri is wearing a red or blue shirt today with jeans.

A red or blue shirt can be represent by p or not p, that is:

[tex](p \vee \neg p)[/tex]

Jeans is not khaki, hence the second part is:

[tex]\neg q[/tex]

Combining the statements, we have that the expression is:

[tex](p \vee \neg p) \wedge \neg q[/tex]

Since p and q are true, [tex]\neg q[/tex] is false, and the entire statement is false. Hence the correct option is:

[tex](p \vee \neg p) \wedge \neg q[/tex]. FALSE.

More can be learned about logic statements at https://brainly.com/question/24912495

#SPJ1

Toyota manufactures most of the vehicles it sells in the United Kingdom in Japan. The base platform for the Toyota Tundra truck line is ¥1,650,000. The spot rate of the Japanese yen against the British pound has recently moved from ¥197/£ to ¥190/£. How does this change the price of the Tundra to Toyota's British subsidiary in British pounds? Explain.

Answers

When the spot rate of the Japanese yen against the British pound moves from ¥197/£ to ¥190/£. This change the price of the Tundra to Toyota's British subsidiary in British pounds by 3.68%.

Prices = 1,650,000

Exchange rates = ¥197/£

Change in exchange rate = ¥190/£

So, here Original price of the Toyota tundra is

                                   = 1,650,000 ÷ 197

                                    = 8375.63

New import price is = 1,650,000 ÷ 190

                              = 8,684.21

Percentage change in the price of the imported trucks should be

= ( New price - Old price) / old price *100                                                                                                                             = (8,684.21 - 8375.63) ÷ 8375.63                                                                                                                   = 3.68%

Hence , when the spot rate of the Japanese yen against the British pound moves from ¥197/£ to ¥190/£. This change the price of the Tundra to Toyota's British subsidiary in British pounds by 3.68%.

(This is the percentage change in the Japanese yen as the price of the truck remains unchanged).

Learn more about price here:

https://brainly.com/question/1153322

#SPJ10

Question 2(Multiple Choice Worth 4 points)
If (89)P=818, what is the value of p?
02
09
10
18

Answers

Answer:

p = 2

Step-by-step explanation:

using the rule of exponents

[tex](a^{m}) ^{n}[/tex] = [tex]a^{mn}[/tex]

[tex](8^{9}) ^{2}[/tex] = [tex]8^{9(2)}[/tex] = [tex]8^{18}[/tex]

so value of p = 2

Which statements are true from the graph ? Check all that apply:
the line is horizontal the line is vertical

Answers

The statements that are true from the graph are:

The line is horizontalThe line goes through (4, 4 )The y- values are all 4

Calculations and Parameters

Given the graph, we can note some things:

There is a line with a slope of zero.This is a horizontal line parallel to the x-axis.The equation of the line is y = c

c is the value of the y- coordinates the line passes through.

The line passes through (0, 4 ) with a y- coordinate of 4

Therefore, the equation of the line of y= 4

Read more about graphs here:

https://brainly.com/question/13483111

#SPJ1

Tickets for a soccer game cost $5 for students and $8 for adults. the number of students was 7 less than 11 times the numbers of adults. the amount of the money from tickets was 3682 how many of each tickets were sold?tichets

Answers

The number of students will be 642 and the number of the adults will be 59.

What is the solution of the equation?

The solution of the equation means the value of the unknown or variable.

Tickets for a soccer game cost $5 for students and $8 for adults.

The number of students was 7 less than 11 times the numbers of adults.

The amount of the money from tickets was 3682.

Let x be the number of students and y be the number of the adults.

Then the equation will be

x = 11y – 7  …1

5x + 8y = 3682 …2

From equation 1 and 2, we have

5(11y – 7) + 8y = 3682

55y + 8y – 35 = 3682

                63y = 3717

                    y = 59

Then the value of x will be

x = 11 × 59 – 7

x = 642

More about the solution of the equation link is given below.

https://brainly.com/question/545403

#SPJ1

Find X and QT. The shape is a Rhombus

Answers

Answer:

See below ~

Step-by-step explanation:

Sides of a rhombus are equal.

⇒ QT = TS

⇒ x² - 4x - 10 = 6x + 14

⇒ x² - 10x - 24 = 0

⇒ x² + 2x - 12x - 24 = 0

⇒ x (x + 2) - 12 (x + 2) = 0

⇒ (x + 2)(x - 12) = 0

⇒ x = -2 or x = 12

Substitute both values and see which gives a positive value for QT :

When x = -2 :

QT = (-2)² - 4(-2) - 10QT = 4 + 8 - 10QT = 2

When x = 12 :

QT = (12)² - 4(12) - 10QT = 144 - 48 - 10QT = 86

The 2 possible answers are :

x = -2, QT = 2x = 12, QT = 86

In your own words, explain the discriminant test. Use the discriminant test to decide whether the equation represents a parabola, ellipse or a hyperbola and explain why you know this is true. x^2 − 4xy + 3x + 25y − 6 = 0

Answers

A discriminant test is one that tells whether a formula has one, two or no solutions.

The equation represents a parabola because the discriminant of a parabola has either x or y squared and not the both.

What is a discriminant test?

A discriminant test is a test that tells whether there are one, two or no solutions for a formula.

The discriminant is the part of the quadratic formula underneath the square root symbol: b²-4ac.

The discriminant of a quadratic equation is given as ax2 + bx + c = 0

A discriminant is said to be a parabola either x or y is squared and not both unlike that of an eclipse and a hyperbola.

With the given equation,  x^2 − 4xy + 3x + 25y − 6 = 0, only x is squared and not both x and y.

Thus, the equation represents a parabola because the discriminant of a parabola has either x or y squared and not the both.

Learn more about discriminant test here:

https://brainly.com/question/4220311

#SPJ1

What is the median of this data set?
22, 37, 49, 15, 72

Answers

Answer: 37

Steps:
Order the numbers from least to greatest.
15, 22, 37, 49, 72

The median value is the middle number.

37

Please help!!! I will give 20 points to the correct answer !! Thanks so much

Answers

The values will be 10 and -6

Calculate the gross earning for an apple picker based on the following differential pay scale: 1- 1000:$0.03 each 1001-1600:$0.06 each over 1600:$0.07 each. Calculate the Gross earning

Answers

If he picks 1965, then the Gross earning will be $85.55.

The missing part of the question is given below.

If he picks 1965, then Calculate the Gross earning.

What is Algebra?

The analysis of mathematical representations is algebra, and the handling of those symbols is logic.

Calculate the gross earning for an apple picker based on the following differential pay scale:

     1 – 1000: $0.03 each

1001 – 1600: $0.06 each

  over 1600: $0.07 each

Total apples picked by Lindbergh = 1965

So, for 1000 apples, he will get =1000 × 0.03 = $30

Now, remaining apples = 1965 – 1000 = 965

Now for next 600 apples (from 1001-1600), he will get = 600 × 0.05 =$30

Now, remaining apples = 965 – 600 = 365

So, for remaining 365 (above 1600) apples, he will get = 365 × 0.07 = $25.55

So, total gross earning = $30 + $30 + $25.55

⇒ $85.55 is total gross earning

More about the Algebra link is given below.

https://brainly.com/question/953809

#SPJ1

Find the value of x.

Answers

Answer:

Step-by-step explanation:

plug in x try numbers

x = 14.2

Add both 79 and 5x+3

If f(x) = 3x − 1 and g(x) = x + 2, find (ƒ– g)(x) ​

Answers

[tex]\quad \huge \quad \quad \boxed{ \tt \:Answer }[/tex]

[tex]\qquad \tt \rightarrow \:2x - 3 [/tex]

____________________________________

[tex] \large \tt Solution \: : [/tex]

[tex]\qquad \tt \rightarrow \: (f - g)(x)[/tex]

[tex]\qquad \tt \rightarrow \: f(x) - g(x)[/tex]

Simple procedure :

[tex]\qquad \tt \rightarrow \: 3x - 1 - (x + 2)[/tex]

[tex]\qquad \tt \rightarrow \: 3x - 1 - x - 2[/tex]

[tex]\qquad \tt \rightarrow \: 3x - x - 1 - 2[/tex]

[tex]\qquad \tt \rightarrow \: 2x - 3[/tex]

Answered by : ❝ AǫᴜᴀWɪᴢ ❞

Based on the vertical bar chart below, in which of the following months were just over 10% of professional European soccer players
born?
March
B) January
April
May
Professional European soccer player birth months
Relative frequency (%)
20%
15%
10%
5%
Jan Feb Mar Apr May Jun
ایل
Month
....
Aug Sep Oct Nov Dec

Answers

By critically observing the vertical bar chart, only the month of May had a birth of just over 10%.

What is a bar chart?

A bar chart refers to a type of chart that is used for the graphical representation of a data set, especially by using rectangular bars or vertical columns.

Based on the vertical bar chart (see attachment), the relative frequency (&) with the birth of over 10% are:

Jan Feb Mar Apr May

However, only the month of May had a birth of just over 10%.

Read more on bar chart here: brainly.com/question/24741444

#SPJ1

forty percent of participants in a math contest were boys. fifty percent of the boys revived medals. the number of boys who received the medals was equal to the number of girls who received the medals. what percent of the participants were girls who received medal?​

Answers

20% of the participants are girls and got a medal, and 33% of the girls got a medal.

What percent of the participants were girls who received medal?​

First, we know that 40% of the participants were boys, so the other 60% were girls.

We know that 50% of the boys got a medal, so the percentage (in decimal form) of participants that are boys and got a medal is:

P = (0.4)*(0.5) = 0.2

So, 20% of the participants are boys and got a medal.

We know that the number of girls that got a medal is the same as the number of boys, then we also have that 20% of the participants are women who got a medal.

Then if the percentage of girls that got a medal is x (in decimal form), we must have that:

Q = (0.6)*(x) = 0.2

      x = 0.2/0.6 = 0.33

x = 0.33

This means that 33% of the girls got a medal.

If you want to learn more about percentages:

https://brainly.com/question/843074

#SPJ1

Other Questions
What is the annual effective absorbed dose equivalent limit for the general public (frequent exposure) PLEASE ANSWER ASAP!!!!!! WILL GIVE BRAINLIEST!!! The vertex of this parabola is at (3-2). When the value is 4 they-value is 3. What is the coefficient of the squared expression in theparabola's equation?A. 7B. 1C. -1D. 5 If f(x) = x + 8 and g(x) = 4x 3, find (f + g)(x). A. (f + g)(x) = 5x + 11 B. (f + g)(x) = 3x + 5 C. (f + g)(x) = 5x 11 D. (f + g)(x) = 3x 5 An architect is designing new housing structures for the primate section at the zoo. Her plan is shown below. Which animals will live in a building that is similar to the main primate house? A orangutans B chimpanzees C gibbons D gorillas What is a 10% margin increase on 1,810.69? How many grams of nitrogen,N2, would be required to react with6.25 moles hydrogen, H2? The Wilson family had 5 children. Assuming that the probability of a child being a girl is 0.5, find the probability that the Wilson family hadat least 3 girls? at most 3 girls? The quadrilateral below is formed from a parallelogram and anisosceles triangle.Calculate the size of angle VQU. read the direct speech below and complete the indirect reporting that f fllows question number 1 I overslept this morning La ltima frase nos desvela el suceso que est ocurriendo en el texto qu gran suceso es ese Study the following list of words. Find all of the words that relate to being QUIET. Use your dictionary or thesaurus if you are not sure of a word's meaning.jumpcrawlboomcreepsplashjangleyellspeedyskipdartfleeshoutbarkloiterhotswiftcracksilencesleepskimpeacecalmimmovablesoftlysoundlessturtledashrapidstillelegantlaghushroarmurmursnailzoom describe the required qualifications occupation of dentist knowing that the client has two risk factors that cannot be modified, which intervention is most important for the nurse to include in the client's plan of care? Which of these was an accomplishment of the Han Dynasty?A.The invention of paper B. The discovery of a water passage to Europe C. The invention of the ballpoint pen D. The invention of the abacus A journey i have made A sequence is defined by the recursive function f(n + 1) = one-half(n). If f(3) = 9 , what is f(1) ? Add.(3+x3+3x2)+(2x324x2)Express the answer in standard form.Enter your answer in the box. Lorenzo and Lila own all of the Double L Corporation's stock. The stock of this corporation is not sold to the general public. Lorenzo and Lila own a(n) The sin (0) = - and lies in Quadrant III. Find the exact values of the sine6'and cosine of 20.